Lineage for d2uwra2 (2uwr A:1-77)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032361Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 3032385Protein CD59 [57355] (1 species)
  7. 3032386Species Human (Homo sapiens) [TaxId:9606] [57356] (11 PDB entries)
  8. 3032388Domain d2uwra2: 2uwr A:1-77 [152220]
    Other proteins in same PDB: d2uwra3, d2uwra4
    automated match to d1cdqa_

Details for d2uwra2

PDB Entry: 2uwr (more details), 1.34 Å

PDB Description: high resolution structure of human cd59
PDB Compounds: (A:) cd59 glycoprotein

SCOPe Domain Sequences for d2uwra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uwra2 g.7.1.3 (A:1-77) CD59 {Human (Homo sapiens) [TaxId: 9606]}
lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt
yycckkdlcnfneqlen

SCOPe Domain Coordinates for d2uwra2:

Click to download the PDB-style file with coordinates for d2uwra2.
(The format of our PDB-style files is described here.)

Timeline for d2uwra2: