SCOPe 2.08: Domain d1lh1a_: 1lh1 A:

Lineage for d1lh1a_ (1lh1 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Leghemoglobin [46481] (2 species)

7. Species Yellow lupine (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries)

8. Domain d1lh1a_: 1lh1 A: [15222]
   complexed with act, hem

Details for d1lh1a_

PDB Entry: 1lh1, 2 Å

PDB Description: x-ray structural investigation of leghemoglobin. vi. structure of acetate-ferrileghemoglobin at a resolution of 2.0 angstroms (russian)

PDB Compounds: (A:) leghemoglobin (aceto met)

SCOPe Domain Sequences for d1lh1a_:

Sequence; same for both SEQRES and ATOM records:

>d1lh1a_ a.1.1.2 (A:) Leghemoglobin {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa

Timeline for d1lh1a_:

• d1lh1a_ first appeared (with stable ids) in SCOP 1.55, called d1lh1__
  
• d1lh1a_ appears in SCOPe 2.07