SCOPe 2.04: Domain d2uwem2: 2uwe M:118-245

Lineage for d2uwem2 (2uwe M:118-245)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)

8. Domain d2uwem2: 2uwe M:118-245 [152219]
   Other proteins in same PDB: d2uwea1, d2uwea2, d2uweb_, d2uwee1, d2uwef1, d2uweh1, d2uweh2, d2uwei_, d2uwel1, d2uwem1
   automatically matched to d1lp9f2
   mutant

Details for d2uwem2

PDB Entry: 2uwe, 2.4 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation

PDB Compounds: (M:) ahiii tcr beta chain

SCOPe Domain Sequences for d2uwem2:

Sequence; same for both SEQRES and ATOM records:

>d2uwem2 b.1.1.2 (M:118-245) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

Timeline for d2uwem2:

• d2uwem2 first appeared in SCOP 1.75
  
• d2uwem2 appears in SCOPe 2.03
  
• d2uwem2 appears in SCOPe 2.05
  
• d2uwem2 appears in the current release, SCOPe 2.08