SCOP 1.75: Domain d2uwef2: 2uwe F:118-245

Lineage for d2uwef2 (2uwe F:118-245)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)

8. Domain d2uwef2: 2uwe F:118-245 [152212]
   Other proteins in same PDB: d2uwea1, d2uwea2, d2uweb1, d2uwee1, d2uwef1, d2uweh1, d2uweh2, d2uwei1, d2uwel1, d2uwem1
   automatically matched to d1lp9f2
   mutant

Details for d2uwef2

PDB Entry: 2uwe, 2.4 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation

PDB Compounds: (F:) ahiii tcr beta chain

SCOP Domain Sequences for d2uwef2:

Sequence; same for both SEQRES and ATOM records:

>d2uwef2 b.1.1.2 (F:118-245) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

Timeline for d2uwef2:

• d2uwef2 is new in SCOP 1.75
  
• d2uwef2 appears in SCOPe 2.01
  
• d2uwef2 appears in the current release, SCOPe 2.08