Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (424 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d2uweb2: 2uwe B:1-99 [152208] Other proteins in same PDB: d2uwea1, d2uwea2, d2uweb3, d2uwee1, d2uwee2, d2uwef1, d2uwef2, d2uweh1, d2uweh2, d2uwei3, d2uwel1, d2uwel2, d2uwem1, d2uwem2 automated match to d1a9bb_ mutant |
PDB Entry: 2uwe (more details), 2.4 Å
SCOPe Domain Sequences for d2uweb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uweb2 b.1.1.2 (B:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d2uweb2: