Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) |
Family c.5.1.0: automated matches [254240] (1 protein) not a true family |
Protein automated matches [254548] (7 species) not a true protein |
Species Escherichia coli [TaxId:562] [255257] (8 PDB entries) |
Domain d2uuoa1: 2uuo A:1-93 [152197] Other proteins in same PDB: d2uuoa2, d2uuoa3, d2uuoa4 automated match to d4uaga1 complexed with lk3, so4 |
PDB Entry: 2uuo (more details), 2.5 Å
SCOPe Domain Sequences for d2uuoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uuoa1 c.5.1.0 (A:1-93) automated matches {Escherichia coli [TaxId: 562]} adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde wlmaadlivaspgialahpslsaaadagieivg
Timeline for d2uuoa1: