Lineage for d2lh5__ (2lh5 -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44475Protein Leghemoglobin [46481] (2 species)
  7. 44481Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries)
  8. 44489Domain d2lh5__: 2lh5 - [15219]

Details for d2lh5__

PDB Entry: 2lh5 (more details), 2 Å

PDB Description: x-ray structural investigation of leghemoglobin. vi. structure of acetate-ferrileghemoglobin at a resolution of 2.0 angstroms (russian)

SCOP Domain Sequences for d2lh5__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lh5__ a.1.1.2 (-) Leghemoglobin {Yellow lupin (Lupinus luteus)}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa

SCOP Domain Coordinates for d2lh5__:

Click to download the PDB-style file with coordinates for d2lh5__.
(The format of our PDB-style files is described here.)

Timeline for d2lh5__: