SCOPe 2.02: Domain d2uudj1: 2uud J:1-113

Lineage for d2uudj1 (2uud J:1-113)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (46 PDB entries)
   Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4

8. Domain d2uudj1: 2uud J:1-113 [152182]
   complexed with phx

Details for d2uudj1

PDB Entry: 2uud, 2.9 Å

PDB Description: crystal structure of the tepc15-vk45.1 anti-2-phenyl-5-oxazolone nq10-1.12 scfv in complex with the hapten

PDB Compounds: (J:) nq10-1.12 anti-phox antibody

SCOPe Domain Sequences for d2uudj1:

Sequence; same for both SEQRES and ATOM records:

>d2uudj1 b.1.1.1 (J:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglvqpggslrlscatsgfsftdyymawvrqppgkalewlafirnkangytt
dysasvkgrftisrdnsqsilylqmntlraedsatyycargdyygawfaywgqgtlvtvs
a

Timeline for d2uudj1:

• d2uudj1 first appeared in SCOP 1.75
  
• d2uudj1 appears in SCOPe 2.01
  
• d2uudj1 appears in SCOPe 2.03
  
• d2uudj1 appears in the current release, SCOPe 2.08