SCOP 1.75: Domain d2rnya1: 2rny A:1077-1197

Lineage for d2rnya1 (2rny A:1077-1197)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (1 family)

5. Family a.29.2.1: Bromodomain [47371] (4 proteins)

6. Protein CREB-binding protein, CBP [74712] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74713] (4 PDB entries)

8. Domain d2rnya1: 2rny A:1077-1197 [152175]
   automatically matched to d1jspb_

Details for d2rnya1

PDB Entry: 2rny

PDB Description: complex structures of cbp bromodomain with h4 ack20 peptide

PDB Compounds: (A:) creb-binding protein

SCOP Domain Sequences for d2rnya1:

Sequence; same for both SEQRES and ATOM records:

>d2rnya1 a.29.2.1 (A:1077-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls
tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
g

Timeline for d2rnya1:

• d2rnya1 is new in SCOP 1.75
  
• d2rnya1 appears in SCOPe 2.01
  
• d2rnya1 appears in the current release, SCOPe 2.08, called d2rnya2