Lineage for d2rnxa1 (2rnx A:715-832)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767485Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 767486Superfamily a.29.2: Bromodomain [47370] (1 family) (S)
  5. 767487Family a.29.2.1: Bromodomain [47371] (4 proteins)
  6. 767502Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)
  7. 767503Species Human (Homo sapiens) [TaxId:9606] [47376] (7 PDB entries)
  8. 767507Domain d2rnxa1: 2rnx A:715-832 [152174]
    automatically matched to d1jm4b_

Details for d2rnxa1

PDB Entry: 2rnx (more details)

PDB Description: the structural basis for site-specific lysine-acetylated histone recognition by the bromodomains of the human transcriptional co- activators pcaf and cbp
PDB Compounds: (A:) Histone acetyltransferase PCAF

SCOP Domain Sequences for d2rnxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rnxa1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk

SCOP Domain Coordinates for d2rnxa1:

Click to download the PDB-style file with coordinates for d2rnxa1.
(The format of our PDB-style files is described here.)

Timeline for d2rnxa1: