SCOP 1.75: Domain d2rnxa1: 2rnx A:715-832

Lineage for d2rnxa1 (2rnx A:715-832)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (1 family)

5. Family a.29.2.1: Bromodomain [47371] (4 proteins)

6. Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47376] (7 PDB entries)

8. Domain d2rnxa1: 2rnx A:715-832 [152174]
   automatically matched to d1jm4b_

Details for d2rnxa1

PDB Entry: 2rnx

PDB Description: the structural basis for site-specific lysine-acetylated histone recognition by the bromodomains of the human transcriptional co- activators pcaf and cbp

PDB Compounds: (A:) Histone acetyltransferase PCAF

SCOP Domain Sequences for d2rnxa1:

Sequence; same for both SEQRES and ATOM records:

>d2rnxa1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk

Timeline for d2rnxa1:

• d2rnxa1 is new in SCOP 1.75
  
• d2rnxa1 appears in SCOPe 2.01
  
• d2rnxa1 appears in the current release, SCOPe 2.08, called d2rnxa2