| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.1: Bromodomain [47371] (6 proteins) |
| Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries) |
| Domain d2rnxa2: 2rnx A:719-832 [152174] Other proteins in same PDB: d2rnxa3 automated match to d2rnxa1 protein/DNA complex |
PDB Entry: 2rnx (more details)
SCOPe Domain Sequences for d2rnxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rnxa2 a.29.2.1 (A:719-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
skeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlk
nryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk
Timeline for d2rnxa2: