SCOPe 2.05: Domain d2rnwa_: 2rnw A:

Lineage for d2rnwa_ (2rnw A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries)

8. Domain d2rnwa_: 2rnw A: [152173]
   automated match to d2rnwa1
   protein/DNA complex

Details for d2rnwa_

PDB Entry: 2rnw

PDB Description: the structural basis for site-specific lysine-acetylated histone recognition by the bromodomains of the human transcriptional co- activators pcaf and cbp

PDB Compounds: (A:) Histone acetyltransferase PCAF

SCOPe Domain Sequences for d2rnwa_:

Sequence; same for both SEQRES and ATOM records:

>d2rnwa_ a.29.2.1 (A:) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk

Timeline for d2rnwa_:

• d2rnwa_ first appeared in SCOP 1.75, called d2rnwa1
  
• d2rnwa_ appears in SCOPe 2.04
  
• d2rnwa_ is called d2rnwa2 in SCOPe 2.06
  
• d2rnwa_ appears in the current release, SCOPe 2.08, called d2rnwa2