SCOPe 2.01: Domain d2rlde_: 2rld E:

Lineage for d2rlde_ (2rld E:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.16: IVS-encoded protein-like [158446] (1 family)
   IVS: Intervening sequence with conserved ORF in eubacterial 23S rRNA genes; forms a homopentamer with a toroid-shaped structure containing a tapered central channel

5. Family a.29.16.1: IVS-encoded protein-like [158447] (3 proteins)
   Pfam PF05635

6. Protein Uncharacterized protein BT0352 [158450] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [158451] (1 PDB entry)
   Uniprot Q8AAW0 1-115

8. Domain d2rlde_: 2rld E: [152154]
   automated match to d2rlda1
   complexed with ca, cl, edo

Details for d2rlde_

PDB Entry: 2rld, 1.7 Å

PDB Description: crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution

PDB Compounds: (E:) Uncharacterized protein

SCOPe Domain Sequences for d2rlde_:

Sequence; same for both SEQRES and ATOM records:

>d2rlde_ a.29.16.1 (E:) Uncharacterized protein BT0352 {Bacteroides thetaiotaomicron [TaxId: 818]}
nvvkdkslefavrivnlykflvneqkefvmskqilrsgtsiganireaeqaqsradfink
lnialkeaneteywlellirteyitreqyesinndsteinkllisiiktt

Timeline for d2rlde_:

• d2rlde_ first appeared in SCOP 1.75, called d2rlde1
  
• d2rlde_ appears in SCOPe 2.02
  
• d2rlde_ appears in the current release, SCOPe 2.08