Lineage for d2gdm__ (2gdm -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (17 proteins) 
Protein Leghemoglobin [46481] (2 species) Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries) 
Domain d2gdm__: 2gdm - [15212]
Details for d2gdm__
PDB Entry: 2gdm (more details), 1.7 Å
PDB Description: leghemoglobin (oxy)
SCOP Domain Sequences for d2gdm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdm__ a.1.1.2 (-) Leghemoglobin {Yellow lupin (Lupinus luteus)}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa
SCOP Domain Coordinates for d2gdm__:
Click to download the PDB-style file with coordinates for d2gdm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gdm__:
- d2gdm__ first appeared (with stable ids) in SCOP 1.55
- d2gdm__ appears in SCOP 1.59
- d2gdm__ appears in the current release, SCOPe 2.08, called d2gdma_
View in 3D