Lineage for d2rk5a1 (2rk5 A:5-88)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875230Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 875231Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (4 families) (S)
  5. 875354Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
    Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain
  6. 875394Protein Putative hemolysin SMU1693 [160821] (1 species)
    HlyX
  7. 875395Species Streptococcus mutans [TaxId:1309] [160822] (1 PDB entry)
    Uniprot O68574 352-435
  8. 875396Domain d2rk5a1: 2rk5 A:5-88 [152108]

Details for d2rk5a1

PDB Entry: 2rk5 (more details), 1.5 Å

PDB Description: Crystal structure of a domain of the putative hemolysin from Streptococcus mutans UA159
PDB Compounds: (A:) Putative hemolysin

SCOP Domain Sequences for d2rk5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rk5a1 d.145.1.4 (A:5-88) Putative hemolysin SMU1693 {Streptococcus mutans [TaxId: 1309]}
reiadntyivlgtmtlndfneyfetdlesdnvdtiagfyltgvgtipsqeekehfevesn
gkhlelindkvkdgrvtklkilvs

SCOP Domain Coordinates for d2rk5a1:

Click to download the PDB-style file with coordinates for d2rk5a1.
(The format of our PDB-style files is described here.)

Timeline for d2rk5a1: