Lineage for d2rjya_ (2rjy A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 908979Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 908980Superfamily a.14.1: VHP, Villin headpiece domain [47050] (1 family) (S)
  5. 908981Family a.14.1.1: VHP, Villin headpiece domain [47051] (4 proteins)
  6. 908991Protein Villin [47052] (2 species)
  7. 908992Species Chicken (Gallus gallus) [TaxId:9031] [47053] (13 PDB entries)
  8. 908994Domain d2rjya_: 2rjy A: [152105]
    automated match to d1qqva_

Details for d2rjya_

PDB Entry: 2rjy (more details), 1.4 Å

PDB Description: Crystal structure of villin headpiece, P21 21 21 space group
PDB Compounds: (A:) Villin-1

SCOPe Domain Sequences for d2rjya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rjya_ a.14.1.1 (A:) Villin {Chicken (Gallus gallus) [TaxId: 9031]}
letfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafanlplwkqqnlkke
kglf

SCOPe Domain Coordinates for d2rjya_:

Click to download the PDB-style file with coordinates for d2rjya_.
(The format of our PDB-style files is described here.)

Timeline for d2rjya_: