SCOPe 2.06: Domain d2ripa2: 2rip A:509-766

Lineage for d2ripa2 (2rip A:509-766)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188340] (73 PDB entries)

8. Domain d2ripa2: 2rip A:509-766 [152096]
   Other proteins in same PDB: d2ripa1
   automated match to d4n8db2
   complexed with 34q, nag

Details for d2ripa2

PDB Entry: 2rip, 2.9 Å

PDB Description: structure of dppiv in complex with an inhibitor

PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2ripa2:

Sequence; same for both SEQRES and ATOM records:

>d2ripa2 c.69.1.0 (A:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d2ripa2:

• d2ripa2 first appeared in SCOP 1.75
  
• d2ripa2 appears in SCOPe 2.05
  
• d2ripa2 appears in SCOPe 2.07
  
• d2ripa2 appears in the current release, SCOPe 2.08