Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (8 families) |
Family d.169.1.1: C-type lectin domain [56437] (28 proteins) Pfam PF00059 |
Protein Surfactant protein, lectin domain [56461] (2 species) |
Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (14 PDB entries) |
Domain d2riec1: 2rie C:235-355 [152087] Other proteins in same PDB: d2riea2, d2rieb2, d2riec2 automatically matched to d1b08a1 complexed with 293, ca |
PDB Entry: 2rie (more details), 1.6 Å
SCOP Domain Sequences for d2riec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2riec1 d.169.1.1 (C:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce f
Timeline for d2riec1:
View in 3D Domains from other chains: (mouse over for more information) d2riea1, d2riea2, d2rieb1, d2rieb2 |