SCOPe 2.03: Domain d2riea1: 2rie A:235-355

Lineage for d2riea1 (2rie A:235-355)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (56 PDB entries)

8. Domain d2riea1: 2rie A:235-355 [152083]
   Other proteins in same PDB: d2riea2, d2rieb2, d2riec2
   complexed with 293, ca

Details for d2riea1

PDB Entry: 2rie, 1.6 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with 2-deoxy-l- glycero-d-manno-heptose

PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2riea1:

Sequence; same for both SEQRES and ATOM records:

>d2riea1 d.169.1.0 (A:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

Timeline for d2riea1:

• d2riea1 first appeared in SCOP 1.75
  
• d2riea1 appears in SCOPe 2.02
  
• d2riea1 appears in SCOPe 2.04
  
• d2riea1 appears in the current release, SCOPe 2.08