Lineage for d2riea1 (2rie A:235-355)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (17 species)
    not a true protein
  7. 2559734Species Human (Homo sapiens) [TaxId:9606] [186882] (84 PDB entries)
  8. 2559819Domain d2riea1: 2rie A:235-355 [152083]
    Other proteins in same PDB: d2riea2, d2rieb2, d2riec2
    complexed with 293, ca

Details for d2riea1

PDB Entry: 2rie (more details), 1.6 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with 2-deoxy-l- glycero-d-manno-heptose
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2riea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2riea1 d.169.1.0 (A:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d2riea1:

Click to download the PDB-style file with coordinates for d2riea1.
(The format of our PDB-style files is described here.)

Timeline for d2riea1: