SCOP 1.75: Domain d1ecoa_: 1eco A:

Lineage for d1ecoa_ (1eco A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Erythrocruorin [46479] (1 species)

7. Species Midge (Chironomus thummi thummi), fraction III [TaxId:7154] [46480] (4 PDB entries)

8. Domain d1ecoa_: 1eco A: [15208]
   complexed with hem

Details for d1ecoa_

PDB Entry: 1eco, 1.4 Å

PDB Description: structure of erythrocruorin in different ligand states refined at 1.4 angstroms resolution

PDB Compounds: (A:) erythrocruorin (carbonmonoxy)

SCOP Domain Sequences for d1ecoa_:

Sequence; same for both SEQRES and ATOM records:

>d1ecoa_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}
lsadqistvqasfdkvkgdpvgilyavfkadpsimakftqfagkdlesikgtapfethan
rivgffskiigelpnieadvntfvashkprgvthdqlnnfragfvsymkahtdfagaeaa
wgatldtffgmifskm

Timeline for d1ecoa_:

• d1ecoa_ first appeared (with stable ids) in SCOP 1.55, called d1eco__
  
• d1ecoa_ appears in SCOP 1.73
  
• d1ecoa_ appears in SCOPe 2.01
  
• d1ecoa_ appears in the current release, SCOPe 2.08