Lineage for d1myt__ (1myt -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44499Protein Myoglobin [46469] (9 species)
  7. 44697Species Yellowfin tuna (Thunnus albacares) [TaxId:8236] [46478] (1 PDB entry)
  8. 44698Domain d1myt__: 1myt - [15207]

Details for d1myt__

PDB Entry: 1myt (more details), 1.74 Å

PDB Description: crystal structure to 1.74 angstroms resolution of metmyoglobin from yellowfin tuna (thunnus albacares): an example of a myoglobin lacking the d helix

SCOP Domain Sequences for d1myt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1myt__ a.1.1.2 (-) Myoglobin {Yellowfin tuna (Thunnus albacares)}
adfdavlkcwgpveadyttmgglvltrlfkehpetqklfpkfagiaqadiagnaaisahg
atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmhekagldagg
qtalrnvmgiiiadleanykelgfsg

SCOP Domain Coordinates for d1myt__:

Click to download the PDB-style file with coordinates for d1myt__.
(The format of our PDB-style files is described here.)

Timeline for d1myt__: