SCOP 1.75: Domain d1lhta_: 1lht A:

Lineage for d1lhta_ (1lht A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Loggerhead sea turtle (Caretta caretta) [TaxId:8467] [46477] (2 PDB entries)

8. Domain d1lhta_: 1lht A: [15205]
   complexed with cyn, hem

Details for d1lhta_

PDB Entry: 1lht, 2 Å

PDB Description: loggerhead sea turtle myoglobin (cyano-met)

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d1lhta_:

Sequence; same for both SEQRES and ATOM records:

>d1lhta_ a.1.1.2 (A:) Myoglobin {Loggerhead sea turtle (Caretta caretta) [TaxId: 8467]}
glsddewnhvlgiwakvepdlsahgqeviirlfqlhpetqerfakfknlttidalkssee
vkkhgttvltalgrilkqknnheqelkplaeshatkhkipvkyleficeiivkviaekhp
sdfgadsqaamkkalelfrndmaskykefgfqg

Timeline for d1lhta_:

• d1lhta_ first appeared (with stable ids) in SCOP 1.55, called d1lht__
  
• d1lhta_ appears in SCOP 1.73
  
• d1lhta_ appears in SCOPe 2.01
  
• d1lhta_ appears in the current release, SCOPe 2.08