SCOPe 2.03: Domain d2rgnc1: 2rgn C:4-180

Lineage for d2rgnc1 (2rgn C:4-180)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoA [52612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52613] (19 PDB entries)
   Uniprot P61586 2-181

8. Domain d2rgnc1: 2rgn C:4-180 [152014]
   Other proteins in same PDB: d2rgna1, d2rgna2, d2rgnd1, d2rgnd2
   automatically matched to d1x86b_
   complexed with alf, gdp, mg

Details for d2rgnc1

PDB Entry: 2rgn, 3.5 Å

PDB Description: crystal structure of p63rhogef complex with galpha-q and rhoa

PDB Compounds: (C:) transforming protein rhoa

SCOPe Domain Sequences for d2rgnc1:

Sequence; same for both SEQRES and ATOM records:

>d2rgnc1 c.37.1.8 (C:4-180) RhoA {Human (Homo sapiens) [TaxId: 9606]}
irkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq

Timeline for d2rgnc1:

• d2rgnc1 first appeared in SCOP 1.75
  
• d2rgnc1 appears in SCOPe 2.02
  
• d2rgnc1 appears in SCOPe 2.04
  
• d2rgnc1 appears in the current release, SCOPe 2.08