Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
Species Mouse (Mus musculus) [TaxId:10090] [142225] (4 PDB entries) Uniprot P21279 38-66,184-354! Uniprot P27600 53-81,204-370! Uniprot P27601 47-75,202-372 |
Domain d2rgna2: 2rgn A:38-66,A:184-354 [152013] Other proteins in same PDB: d2rgna1, d2rgnc1, d2rgnd1, d2rgnf1 automatically matched to d2bcjq2 complexed with alf, gdp, mg |
PDB Entry: 2rgn (more details), 3.5 Å
SCOP Domain Sequences for d2rgna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rgna2 c.37.1.8 (A:38-66,A:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} relkllllgtgesgkstfikqmriihgsgXvpttgiieypfdlqsvifrmvdvggqrser rkwihcfenvtsimflvalseydqvlvesdnenrmeeskalfrtiitypwfqnssvilfl nkkdlleekimyshlvdyfpeydgpqrdaqaarefilkmfvdlnpdsdkiiyshftcatd tenirfvfaavkdtilqlnlk
Timeline for d2rgna2:
View in 3D Domains from other chains: (mouse over for more information) d2rgnc1, d2rgnd1, d2rgnd2, d2rgnf1 |