Lineage for d2rfka2 (2rfk A:8-252)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881678Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 881679Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 881694Family d.265.1.2: Pseudouridine synthase II TruB [69746] (1 protein)
    contains C-terminal PUA domain
  6. 881695Protein Pseudouridine synthase II TruB [69747] (5 species)
  7. 881698Species Archaeon Pyrococcus furiosus [TaxId:2261] [143434] (3 PDB entries)
    Uniprot Q7LWY0 5-249
  8. 881702Domain d2rfka2: 2rfk A:8-252 [151997]
    Other proteins in same PDB: d2rfka1, d2rfkb1, d2rfkc1
    automatically matched to d2ey4a2
    complexed with zn; mutant

Details for d2rfka2

PDB Entry: 2rfk (more details), 2.87 Å

PDB Description: substrate rna positioning in the archaeal h/aca ribonucleoprotein complex
PDB Compounds: (A:) Probable tRNA pseudouridine synthase B

SCOP Domain Sequences for d2rfka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rfka2 d.265.1.2 (A:8-252) Pseudouridine synthase II TruB {Archaeon Pyrococcus furiosus [TaxId: 2261]}
evrrilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevva
wikkilnlekaghggtlapkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedk
iiqvmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirsli
hhiglalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpme
kaveh

SCOP Domain Coordinates for d2rfka2:

Click to download the PDB-style file with coordinates for d2rfka2.
(The format of our PDB-style files is described here.)

Timeline for d2rfka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rfka1