Lineage for d1bje__ (1bje -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) Protein Myoglobin [46469] (9 species) 
Species Horse (Equus caballus) [TaxId:9796] [46474] (13 PDB entries) 
Domain d1bje__: 1bje - [15197]
Details for d1bje__
PDB Entry: 1bje (more details), 1.8 Å
PDB Description: h64t variant of myoglobin (horse heart) recombinant wild-type complexed with azide
SCOP Domain Sequences for d1bje__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bje__ a.1.1.2 (-) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkktgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg
SCOP Domain Coordinates for d1bje__:
Click to download the PDB-style file with coordinates for d1bje__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bje__:
- d1bje__ appears in SCOP 1.57
- d1bje__ appears in the current release, SCOPe 2.08, called d1bjea_
View in 3D