Class a: All alpha proteins [46456] (284 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein Cytochrome c nitrite reductase [48718] (4 species) |
Species Escherichia coli [TaxId:562] [74807] (2 PDB entries) |
Domain d2rdzb1: 2rdz B:38-477 [151968] automatically matched to d1gu6a_ complexed with ca, edo, hec, so4 |
PDB Entry: 2rdz (more details), 1.74 Å
SCOP Domain Sequences for d2rdzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rdzb1 a.138.1.3 (B:38-477) Cytochrome c nitrite reductase {Escherichia coli [TaxId: 562]} veaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghafa vtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivnn lgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchveyy fdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihgk nnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsin dlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhapee glrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekqd fiktvipqweeqarknglls
Timeline for d2rdzb1: