Lineage for d1rsea_ (1rse A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759576Protein Myoglobin [46469] (9 species)
  7. 759581Species Horse (Equus caballus) [TaxId:9796] [46474] (45 PDB entries)
  8. 759610Domain d1rsea_: 1rse A: [15196]
    complexed with hem, so4; mutant

Details for d1rsea_

PDB Entry: 1rse (more details), 1.7 Å

PDB Description: myoglobin (horse heart) mutant with ser 92 replaced by asp (s92d)
PDB Compounds: (A:) horse heart myoglobin

SCOP Domain Sequences for d1rsea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsea_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqdhatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOP Domain Coordinates for d1rsea_:

Click to download the PDB-style file with coordinates for d1rsea_.
(The format of our PDB-style files is described here.)

Timeline for d1rsea_: