SCOP 1.73: Domain d1wlaa_: 1wla A:

Lineage for d1wlaa_ (1wla A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (32 PDB entries)

8. Domain d1wlaa_: 1wla A: [15195]
   complexed with hem, so4

Details for d1wlaa_

PDB Entry: 1wla, 1.7 Å

PDB Description: myoglobin (horse heart) recombinant wild-type

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d1wlaa_:

Sequence; same for both SEQRES and ATOM records:

>d1wlaa_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d1wlaa_:

• d1wlaa_ first appeared (with stable ids) in SCOP 1.55, called d1wla__
  
• d1wlaa_ was called d1wla__ in SCOP 1.71
  
• d1wlaa_ appears in SCOP 1.75
  
• d1wlaa_ appears in the current release, SCOPe 2.08