Lineage for d2rdoc1 (2rdo C:125-269)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1121207Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 1121370Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 1121371Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 1121381Species Escherichia coli [TaxId:562] [159027] (27 PDB entries)
    Uniprot P60422 125-269
  8. 1121406Domain d2rdoc1: 2rdo C:125-269 [151939]
    Other proteins in same PDB: d2rdo01, d2rdo11, d2rdo31, d2rdo41, d2rdo81, d2rdoc2, d2rdod1, d2rdoe1, d2rdof1, d2rdog1, d2rdog2, d2rdoh1, d2rdoh2, d2rdoi1, d2rdoi2, d2rdoj1, d2rdok1, d2rdol1, d2rdom1, d2rdon1, d2rdoo1, d2rdop1, d2rdoq1, d2rdor1, d2rdos1, d2rdot1, d2rdou1, d2rdov1, d2rdow1, d2rdox1, d2rdoy1, d2rdoz1
    automatically matched to 2AW4 C:125-269

Details for d2rdoc1

PDB Entry: 2rdo (more details), 9.1 Å

PDB Description: 50s subunit with ef-g(gdpnp) and rrf bound
PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2rdoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdoc1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
pgntlpmrnipvgstvhnvemkpgkggqlarsagtyvqivardgayvtlrlrsgemrkve
adcratlgevgnaehmlrvlgkagaarwrgvrptvrgtamnpvdhphgggegrnfgkhpv
tpwgvqtkgkktrsnkrtdkfivrr

SCOPe Domain Coordinates for d2rdoc1:

Click to download the PDB-style file with coordinates for d2rdoc1.
(The format of our PDB-style files is described here.)

Timeline for d2rdoc1: