Lineage for d2rdjb1 (2rdj B:241-341)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008408Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 3008409Protein DinB homolog (DBH) [100881] (3 species)
  7. 3008418Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries)
  8. 3008459Domain d2rdjb1: 2rdj B:241-341 [151932]
    Other proteins in same PDB: d2rdja2, d2rdjb2
    automated match to d1jx4a1
    protein/DNA complex; complexed with ca, gol, tmp

Details for d2rdjb1

PDB Entry: 2rdj (more details), 2.2 Å

PDB Description: snapshots of a y-family dna polymerase in replication: dpo4 in apo and binary/ternary complex forms
PDB Compounds: (B:) DNA polymerase IV

SCOPe Domain Sequences for d2rdjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdjb1 d.240.1.1 (B:241-341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOPe Domain Coordinates for d2rdjb1:

Click to download the PDB-style file with coordinates for d2rdjb1.
(The format of our PDB-style files is described here.)

Timeline for d2rdjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rdjb2