Lineage for d2rdbc_ (2rdb C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1196311Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 1196312Family d.15.12.1: TmoB-like [110815] (1 protein)
    Pfam PF06234
  6. 1196313Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (2 species)
  7. 1196325Species Pseudomonas stutzeri [TaxId:316] [110817] (6 PDB entries)
    Uniprot O87799
  8. 1196329Domain d2rdbc_: 2rdb C: [151923]
    Other proteins in same PDB: d2rdba_, d2rdbb_
    automated match to d1t0rc_
    complexed with fe, gol, mpo, p6g; mutant

Details for d2rdbc_

PDB Entry: 2rdb (more details), 2.1 Å

PDB Description: x-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase i100w mutant
PDB Compounds: (C:) Toluene, o-xylene monooxygenase oxygenase subunit;gamma

SCOPe Domain Sequences for d2rdbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdbc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri [TaxId: 316]}
tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
prgmivsdaglrptetldiifmd

SCOPe Domain Coordinates for d2rdbc_:

Click to download the PDB-style file with coordinates for d2rdbc_.
(The format of our PDB-style files is described here.)

Timeline for d2rdbc_: