SCOPe 2.02: Domain d2rdbb_: 2rdb B:

Lineage for d2rdbb_ (2rdb B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species)

7. Species Pseudomonas stutzeri [TaxId:316] [109791] (6 PDB entries)
   Uniprot O87802

8. Domain d2rdbb_: 2rdb B: [151922]
   Other proteins in same PDB: d2rdba_, d2rdbc_
   automated match to d1t0rb_
   complexed with fe, gol, mpo, p6g; mutant

Details for d2rdbb_

PDB Entry: 2rdb, 2.1 Å

PDB Description: x-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase i100w mutant

PDB Compounds: (B:) Toluene, o-xylene monooxygenase oxygenase subunit;beta

SCOPe Domain Sequences for d2rdbb_:

Sequence; same for both SEQRES and ATOM records:

>d2rdbb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas stutzeri [TaxId: 316]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmg

Timeline for d2rdbb_:

• d2rdbb_ first appeared in SCOP 1.75, called d2rdbb1
  
• d2rdbb_ appears in SCOPe 2.01
  
• d2rdbb_ appears in SCOPe 2.03
  
• d2rdbb_ appears in the current release, SCOPe 2.08