SCOPe 2.01: Domain d2rcxb_: 2rcx B:

Lineage for d2rcxb_ (2rcx B:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (66 PDB entries)

8. Domain d2rcxb_: 2rcx B: [151914]
   automated match to d1c3ba_
   complexed with po4, sm4

Details for d2rcxb_

PDB Entry: 2rcx, 2 Å

PDB Description: ampc beta-lactamase in complex with (1r)-1-(2-thiophen-2-yl- acetylamino)-1-(3-(2-carboxyvinyl)-phenyl) methylboronic acid

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d2rcxb_:

Sequence; same for both SEQRES and ATOM records:

>d2rcxb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d2rcxb_:

• d2rcxb_ first appeared in SCOP 1.75, called d2rcxb1
  
• d2rcxb_ appears in SCOPe 2.02
  
• d2rcxb_ appears in the current release, SCOPe 2.08