SCOPe 2.06: Domain d2rcwa2: 2rcw A:138-350

Lineage for d2rcwa2 (2rcw A:138-350)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
   automatically mapped to Pfam PF00644

6. Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103339] (8 PDB entries)
   Uniprot P09874 661-1010

8. Domain d2rcwa2: 2rcw A:138-350 [151912]
   Other proteins in same PDB: d2rcwa1
   automated match to d1uk1a2
   protein/DNA complex; complexed with aai

Details for d2rcwa2

PDB Entry: 2rcw, 2.8 Å

PDB Description: PARP complexed with A620223

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d2rcwa2:

Sequence; same for both SEQRES and ATOM records:

>d2rcwa2 d.166.1.2 (A:138-350) Poly(ADP-ribose) polymerase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhnrr
llwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpigl
illgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgissg
vndtsllyneyivydiaqvnlkyllklkfnfkt

Timeline for d2rcwa2:

• d2rcwa2 first appeared in SCOP 1.75
  
• d2rcwa2 appears in SCOPe 2.05
  
• d2rcwa2 appears in SCOPe 2.07
  
• d2rcwa2 appears in the current release, SCOPe 2.08