Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (32 PDB entries) |
Domain d2rcjm1: 2rcj M:11-116 [151902] Other proteins in same PDB: d2rcja2, d2rcjb2, d2rcje2, d2rcjf2, d2rcji2, d2rcjj2, d2rcjm2, d2rcjn2, d2rcjq2, d2rcjr2, d2rcju1 automatically matched to d1ymme1 |
PDB Entry: 2rcj (more details)
SCOPe Domain Sequences for d2rcjm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcjm1 b.1.1.1 (M:11-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} vvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhyadsvkgrfti srndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtv
Timeline for d2rcjm1: