SCOPe 2.06: Domain d2rc0x_: 2rc0 X:

Lineage for d2rc0x_ (2rc0 X:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (198 PDB entries)
   Uniprot P00431

8. Domain d2rc0x_: 2rc0 X: [151864]
   automated match to d1ac4a_
   complexed with 284, hem, po4

Details for d2rc0x_

PDB Entry: 2rc0, 1.5 Å

PDB Description: cytochrome c peroxidase w191g in complex with 2-imino-4- methylpiperdine

PDB Compounds: (X:) cytochrome c peroxidase

SCOPe Domain Sequences for d2rc0x_:

Sequence; same for both SEQRES and ATOM records:

>d2rc0x_ a.93.1.1 (X:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl
knsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
kylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

Timeline for d2rc0x_:

• d2rc0x_ first appeared in SCOP 1.75, called d2rc0x1
  
• d2rc0x_ appears in SCOPe 2.05
  
• d2rc0x_ appears in SCOPe 2.07
  
• d2rc0x_ appears in the current release, SCOPe 2.08