Lineage for d2rc0x_ (2rc0 X:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496989Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1496990Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1496991Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1497010Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 1497011Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (170 PDB entries)
    Uniprot P00431
  8. 1497042Domain d2rc0x_: 2rc0 X: [151864]
    automated match to d1ac4a_
    complexed with 284, hem, po4

Details for d2rc0x_

PDB Entry: 2rc0 (more details), 1.5 Å

PDB Description: cytochrome c peroxidase w191g in complex with 2-imino-4- methylpiperdine
PDB Compounds: (X:) cytochrome c peroxidase

SCOPe Domain Sequences for d2rc0x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rc0x_ a.93.1.1 (X:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl
knsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
kylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d2rc0x_:

Click to download the PDB-style file with coordinates for d2rc0x_.
(The format of our PDB-style files is described here.)

Timeline for d2rc0x_: