SCOPe 2.03: Domain d2rbvx_: 2rbv X:

Lineage for d2rbvx_ (2rbv X:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (170 PDB entries)
   Uniprot P00431

8. Domain d2rbvx_: 2rbv X: [151859]
   automated match to d1ac4a_
   complexed with 278, hem, po4

Details for d2rbvx_

PDB Entry: 2rbv, 1.39 Å

PDB Description: cytochrome c peroxidase in complex with (1-methyl-1h-pyrrol-2-yl)- methylamine

PDB Compounds: (X:) cytochrome c peroxidase

SCOPe Domain Sequences for d2rbvx_:

Sequence; same for both SEQRES and ATOM records:

>d2rbvx_ a.93.1.1 (X:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl
knsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
kylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

Timeline for d2rbvx_:

• d2rbvx_ first appeared in SCOP 1.75, called d2rbvx1
  
• d2rbvx_ appears in SCOPe 2.02
  
• d2rbvx_ appears in SCOPe 2.04
  
• d2rbvx_ appears in the current release, SCOPe 2.08