Lineage for d1ycbb_ (1ycb B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) Protein Myoglobin [46469] (9 species) 
Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries) 
Domain d1ycbb_: 1ycb B: [15184]
Details for d1ycbb_
PDB Entry: 1ycb (more details), 2.1 Å
PDB Description: distal pocket polarity in ligand binding to myoglobin: deoxy and carbonmonoxy forms of a threonine68 (e11) mutant investigated by x-ray crystallography and infrared spectroscopy
SCOP Domain Sequences for d1ycbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ycbb_ a.1.1.2 (B:) Myoglobin {Pig (Sus scrofa)}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg
SCOP Domain Coordinates for d1ycbb_:
Click to download the PDB-style file with coordinates for d1ycbb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ycbb_:
- d1ycbb_ appears in SCOP 1.57
- d1ycbb_ appears in the current release, SCOPe 2.08
View in 3D
