Lineage for d1mnka_ (1mnk A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632833Protein Myoglobin [46469] (9 species)
  7. 632876Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 632899Domain d1mnka_: 1mnk A: [15181]

Details for d1mnka_

PDB Entry: 1mnk (more details), 2.2 Å

PDB Description: interactions among residues cd3, e7, e10 and e11 in myoglobins: attempts to simulate the o2 and co binding properties of aplysia myoglobin
PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d1mnka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnka_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkvgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgf

SCOP Domain Coordinates for d1mnka_:

Click to download the PDB-style file with coordinates for d1mnka_.
(The format of our PDB-style files is described here.)

Timeline for d1mnka_: