SCOP 1.71: Domain d1mnka_: 1mnk A:

Lineage for d1mnka_ (1mnk A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)

8. Domain d1mnka_: 1mnk A: [15181]

Details for d1mnka_

PDB Entry: 1mnk, 2.2 Å

PDB Description: interactions among residues cd3, e7, e10 and e11 in myoglobins: attempts to simulate the o2 and co binding properties of aplysia myoglobin

SCOP Domain Sequences for d1mnka_:

Sequence; same for both SEQRES and ATOM records:

>d1mnka_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa)}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkvgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgf

Timeline for d1mnka_:

• d1mnka_ first appeared (with stable ids) in SCOP 1.55
  
• d1mnka_ appears in SCOP 1.69
  
• d1mnka_ appears in SCOP 1.73
  
• d1mnka_ appears in the current release, SCOPe 2.08