Lineage for d2r9wb_ (2r9w B:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1232773Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1232774Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1232775Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1232789Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1232808Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (67 PDB entries)
  8. 1232844Domain d2r9wb_: 2r9w B: [151807]
    automated match to d1c3ba_
    complexed with 23c, po4

Details for d2r9wb_

PDB Entry: 2r9w (more details), 1.8 Å

PDB Description: ampc beta-lactamase with bound phthalamide inhibitor
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d2r9wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r9wb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOPe Domain Coordinates for d2r9wb_:

Click to download the PDB-style file with coordinates for d2r9wb_.
(The format of our PDB-style files is described here.)

Timeline for d2r9wb_: