SCOPe 2.08: Domain d2r9kb2: 2r9k B:385-510

Lineage for d2r9kb2 (2r9k B:385-510)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species European mistletoe (Viscum album) [TaxId:3972] [50375] (12 PDB entries)
   different sequence variants
   Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity

8. Domain d2r9kb2: 2r9k B:385-510 [151791]
   Other proteins in same PDB: d2r9ka_
   automated match to d1m2tb2
   complexed with cl, gol, nag, sgi, so4

Details for d2r9kb2

PDB Entry: 2r9k, 2.7 Å

PDB Description: crystal structure of misteltoe lectin i in complex with phloretamide

PDB Compounds: (B:) Beta-galactoside-specific lectin 1

SCOPe Domain Sequences for d2r9kb2:

Sequence; same for both SEQRES and ATOM records:

>d2r9kb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
taprettiygfrdlcmesaggsvyvetctagqenqrwalygdgsirpkqlqsqcltngrd
sistvinivscsagssgqrwvftnegailnlknglamdvaqanpslqriiiypatgnpnq
mwlpvp

Timeline for d2r9kb2:

• d2r9kb2 first appeared in SCOP 1.75
  
• d2r9kb2 appears in SCOPe 2.07