SCOP 1.73: Domain d1myhb_: 1myh B:

Lineage for d1myhb_ (1myh B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)

8. Domain d1myhb_: 1myh B: [15178]
   complexed with hem, so4; mutant

Details for d1myhb_

PDB Entry: 1myh, 1.9 Å

PDB Description: high resolution x-ray structures of pig metmyoglobin and two cd3 mutants mb(lys45-> arg) and mb(lys45-> ser)

PDB Compounds: (B:) Myoglobin

SCOP Domain Sequences for d1myhb_:

Sequence; same for both SEQRES and ATOM records:

>d1myhb_ a.1.1.2 (B:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdrfkhlksedemkased
lkkhgntvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

Timeline for d1myhb_:

• d1myhb_ first appeared (with stable ids) in SCOP 1.55
  
• d1myhb_ appears in SCOP 1.71
  
• d1myhb_ appears in SCOP 1.75
  
• d1myhb_ appears in the current release, SCOPe 2.08