Class a: All alpha proteins [46456] (284 folds) |
Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 proteins) |
Protein Uncharacterized protein EfaeDRAFT_0938 [158603] (1 species) |
Species Enterococcus faecium [TaxId:1352] [158604] (2 PDB entries) Uniprot Q3XY27 238-423! Uniprot Q3XY27 241-328 |
Domain d2r9ge_: 2r9g E: [151772] automated match to d2r9ga1 complexed with act, gol |
PDB Entry: 2r9g (more details), 2.09 Å
SCOPe Domain Sequences for d2r9ge_:
Sequence, based on SEQRES records: (download)
>d2r9ge_ a.80.1.2 (E:) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]} dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr dshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyr ikewke
>d2r9ge_ a.80.1.2 (E:) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]} dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr dshyrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke
Timeline for d2r9ge_: