SCOPe 2.01: Domain d2r9gd_: 2r9g D:

Lineage for d2r9gd_ (2r9g D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 proteins)

6. Protein Uncharacterized protein EfaeDRAFT_0938 [158603] (1 species)

7. Species Enterococcus faecium [TaxId:1352] [158604] (2 PDB entries)
   Uniprot Q3XY27 238-423! Uniprot Q3XY27 241-328

8. Domain d2r9gd_: 2r9g D: [151771]
   automated match to d2r9ga1
   complexed with act, gol

Details for d2r9gd_

PDB Entry: 2r9g, 2.09 Å

PDB Description: crystal structure of the c-terminal fragment of aaa atpase from enterococcus faecium

PDB Compounds: (D:) AAA ATPase, central region

SCOPe Domain Sequences for d2r9gd_:

Sequence, based on SEQRES records:

>d2r9gd_ a.80.1.2 (D:) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
dshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyr
ikewke

Sequence, based on observed residues (ATOM records):

>d2r9gd_ a.80.1.2 (D:) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
dshynrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke

Timeline for d2r9gd_:

• d2r9gd_ first appeared in SCOP 1.75, called d2r9gd1
  
• d2r9gd_ appears in SCOPe 2.02
  
• d2r9gd_ appears in the current release, SCOPe 2.08, called d2r9gd2