| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein) |
| Protein Calpain large subunit, catalytic domain (domain II) [54041] (5 species) includes the N-terminal 'sequence' domain I |
| Species Rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (10 PDB entries) Uniprot P97571 33-353 |
| Domain d2r9fa1: 2r9f A:33-354 [151767] automatically matched to d1tloa_ complexed with ca, cl, gol, k2z |
PDB Entry: 2r9f (more details), 1.6 Å
SCOPe Domain Sequences for d2r9fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r9fa1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}
naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegyagifhfq
lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse
afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh
aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg
efwmsfrdfireftkleicnlt
Timeline for d2r9fa1: