Lineage for d2r93j1 (2r93 J:1-65)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763391Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
  5. 763392Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
    Zn-binding site is near the N-terminus
  6. 763393Protein RNA polymerase subunit RPB10 [46926] (2 species)
  7. 763396Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (29 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 763411Domain d2r93j1: 2r93 J:1-65 [151760]
    Other proteins in same PDB: d2r93a1, d2r93b1, d2r93d1, d2r93f1, d2r93g1, d2r93h1, d2r93k1, d2r93l1
    automatically matched to d1i3qj_
    complexed with mg, zn

Details for d2r93j1

PDB Entry: 2r93 (more details), 4 Å

PDB Description: elongation complex of rna polymerase ii with a hepatitis delta virus- derived rna stem loop
PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III subunit RPABC5

SCOP Domain Sequences for d2r93j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r93j1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOP Domain Coordinates for d2r93j1:

Click to download the PDB-style file with coordinates for d2r93j1.
(The format of our PDB-style files is described here.)

Timeline for d2r93j1: